Search results for " synchrotron"

showing 10 items of 29 documents

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Indication of a Pulsar Wind Nebula in the Hard X-Ray Emission from SN 1987A

2021

Since the day of its explosion, SN 1987A (SN87A) was closely monitored with the aim to study its evolution and to detect its central compact relic. The detection of neutrinos from the supernova strongly supports the formation of a neutron star (NS). However, the constant and fruitless search for this object has led to different hypotheses on its nature. Up to date, the detection in the ALMA data of a feature somehow compatible with the emission arising from a proto Pulsar Wind Nebula (PWN) is the only hint of the existence of such elusive compact object. Here we tackle this 33-years old issue by analyzing archived observations of SN87A performed Chandra and NuSTAR in different years. We fir…

010504 meteorology & atmospheric sciencesSupernova remnantsAstrophysics::High Energy Astrophysical PhenomenaFOS: Physical sciencesSynchrotron radiationAstrophysics::Cosmology and Extragalactic AstrophysicsAstrophysicsCompact starX-ray sources01 natural sciencesPulsar wind nebulaNeutron starsX-ray astronomy0103 physical sciencesPlasma astrophysicsEjectaX-ray point sources010303 astronomy & astrophysicsCompact objectsX-ray observatoriesShocksAstrophysics::Galaxy Astrophysics0105 earth and related environmental sciencesHigh Energy Astrophysical Phenomena (astro-ph.HE)PhysicsX-ray astronomyAstronomy and AstrophysicsNeutron starSupernovaInterstellar synchrotron emissionSpace and Planetary ScienceNeutrinoAstrophysics - High Energy Astrophysical Phenomena
researchProduct

Paleohistology of the Cretaceous resin‐producing conifer Geinitzia reichenbachii using X‐ray synchrotron microtomography

2021

International audience; PremiseThe conifer Geinitzia reichenbachii was a common member of the Cretaceous Laurasian floras. However, the histology of G. reichenbachii leafy axes was never described in detail, and our knowledge of its paleoecology remains very limited. Using new and exquisitely preserved silicified material from the Upper Cretaceous of western France, we describe G. reichenbachii from the gross morphology to the cellular scale, then discuss paleoecological and taphonomical implications.MethodsWe examined specimens from two localities in western France (Claix and Moragne) using propagation phase-contrast X-ray synchrotron microtomography.ResultsThe cuticle and the inner tissue…

0106 biological sciences010506 paleontologyContext (language use)Plant ScienceBiology010603 evolutionary biology01 natural sciencesSedimentary depositional environmentPaleontologyGeneticsMesozoicleafy twigsEcosystemEcology Evolution Behavior and Systematics0105 earth and related environmental sciencespaleoecophysiologyPermineralizationpermineralizationX-RaysConiferalesX-ray synchrotron microtomographX-Ray MicrotomographyGeinitziaceae15. Life on landCretaceousAmberTracheophyta[SDE]Environmental SciencesPaleobotanyTracheidPaleoecologyfossilssilicification[SDU.STU.PG]Sciences of the Universe [physics]/Earth Sciences/PaleontologySynchrotronsMesozoic paleobotanyAmerican Journal of Botany
researchProduct

Strong Bonding of Single C60 Molecules to (1 × 2)-Pt(110): an STM/DFT Investigation.

2007

International audience; The interaction of single C60 molecules with the (1 × 2)-Pt(110) surface has been studied by scanning tunneling microscopy and density functional theory (DFT) calculations on slab models. Molecules are observed to be frozen at room temperature and are found to be almost exclusively in the same configuration. Extensive DFT calculations show that this configuration is the global energy minimum, suggesting that adsorbed molecules have enough rototranslational freedom to escape from the numerous local minima. The adsorption energy (3.81 eV) is the strongest ever found for C60, and it is roughly proportional to the number of the Pt and C atoms at contact distance. Analysi…

Global energySCANNING TUNNELING MICROSCOPE; SYNCHROTRON-RADIATION; SURFACE; DIFFRACTION; CLUSTERS; AU(111); PT(111); FILMS; STM; ADSORPTIONChemistry02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesSurfaces Coatings and FilmsElectronic Optical and Magnetic Materialslaw.inventionCharacterization (materials science)CrystallographyGeneral EnergyAdsorptionChemical physicslawCovalent bond0103 physical sciencesMoleculeDensity functional theoryPhysical and Theoretical ChemistryScanning tunneling microscope010306 general physics0210 nano-technologyAdsorption energy
researchProduct

Liquid structure and dynamics in the choline acetate:urea 1:2 deep eutectic solvent

2021

We report on the thermodynamic, structural, and dynamic properties of a recently proposed deep eutectic solvent, formed by choline acetate (ChAc) and urea (U) at the stoichiometric ratio 1:2, hereinafter indicated as ChAc:U. Although the crystalline phase melts at 36-38 degrees C depending on the heating rate, ChAc:U can be easily supercooled at sub-ambient conditions, thus maintaining at the liquid state, with a glass-liquid transition at about -50 degrees C. Synchrotron high energy x-ray scattering experiments provide the experimental data for supporting a reverse Monte Carlo analysis to extract structural information at the atomistic level. This exploration of the liquid structure of ChA…

IONIC LIQUIDMONTE-CARLO CHLORIDE SCATTERING WATER NANOSTRUCTURE NANOSCALEsynchrotron radiationeutecticnuclear relaxationX-ray scatteringhydrogen bondingNMRcholine acetatemolecular dynamicsX-rayMOLECULAR-DYNAMICScholinedeep eutectic solvents X-ray scattering synchrotron radiation NMR nuclear relaxation molecular dynamics choline acetateNUCLEAR-MAGNETIC-RESONANCE MOLECULAR-DYNAMICS IONIC LIQUID SFREE ANALYZER MONTE-CARLO CHLORIDE SCATTERING WATER NANOSTRUCTURE NANOSCALESFREE ANALYZERdeep eutectic solvent thermodynamic properties structural properties dynamic propertiesNUCLEAR-MAGNETIC-RESONANCEdeep eutectic solventsSettore CHIM/02 - Chimica Fisica
researchProduct

An Investigation of the Pressure-Induced Structural Phase Transition of Nanocrystalline alpha-CuMoO4

2022

The structural behavior of nanocrystalline α-CuMoO4 was studied at ambient temperature up to 2 GPa using in situ synchrotron X-ray powder diffraction. We found that nanocrystalline α-CuMoO4 undergoes a structural phase transition into γ-CuMoO4 at 0.5 GPa. The structural sequence is analogous to the behavior of its bulk counterpart, but the transition pressure is doubled. A coexistence of both phases was observed till 1.2 GPa. The phase transition gives rise to a change in the copper coordination from square-pyramidal to octahedral coordination. The transition involves a volume reduction of 13% indicating a first-order nature of the phase transition. This transformation was…

Inorganic ChemistryCondensed Matter::Materials Sciencehigh pressure; phase transition; synchrotron radiation; X-ray diffractionGeneral Chemical EngineeringFísicaGeneral Materials ScienceCondensed Matter PhysicsMaterials
researchProduct

Precision luminosity measurements at LHCb

2014

Measuring cross-sections at the LHC requires the luminosity to be determined accurately at each centre-of-mass energy $\sqrt{s}$. In this paper results are reported from the luminosity calibrations carried out at the LHC interaction point 8 with the LHCb detector for $\sqrt{s}$ = 2.76, 7 and 8 TeV (proton-proton collisions) and for $\sqrt{s_{NN}}$ = 5 TeV (proton-lead collisions). Both the "van der Meer scan" and "beam-gas imaging" luminosity calibration methods were employed. It is observed that the beam density profile cannot always be described by a function that is factorizable in the two transverse coordinates. The introduction of a two-dimensional description of the beams improves sig…

Instrumentation for particle accelerators and storage rings - high energy (linear acceleratorsHigh Energy Physics - ExperimentHigh Energy Physics - Experiment (hep-ex)cluster finding[PHYS.HEXP]Physics [physics]/High Energy Physics - Experiment [hep-ex]Nuclear Experiment06.20.fbInstrumentationMathematical PhysicsQCPhysicsLuminosity (scattering theory)Large Hadron ColliderPattern recognition cluster finding calibration and fitting methodssynchrotrons)DetectorPattern recognition cluster finding calibration and fitting methodsComputer interfacecalibration and fitting methodsFísica nuclearTracking and position-sensitive detectorLHCParticle Physics - ExperimentParticle physics29.40.GxPattern recognition cluster finding calibration and fitting methods; Instrumentation for particle accelerators and storage rings - high energy (linear accelerators synchrotrons)Astrophysics::High Energy Astrophysical PhenomenaFOS: Physical sciencesAstrophysics::Cosmology and Extragalactic AstrophysicsLHCb - Abteilung HofmannPattern recognition cluster finding calibration and fitting methodInstrumentation for particle accelerators and storage rings - high energy (linear accelerators synchrotrons)NOConsistency (statistics)Pattern recognitionCalibrationSDG 7 - Affordable and Clean EnergyInstrumentation for particle accelerators and storage rings - high energy (linear accelerators synchrotrons)/dk/atira/pure/sustainabledevelopmentgoals/affordable_and_clean_energyInteraction pointStandards and calibrationFunction (mathematics)29.50.+vLHCbInstrumentation for particle accelerators and storage rings - high energy (linear accelerators synchrotrons); Pattern recognition cluster finding calibration and fitting methods; Instrumentation; Mathematical PhysicsTEVPhysics::Accelerator PhysicsHigh Energy Physics::ExperimentInstrumentation for particle accelerators and storage rings - high energy (linear accelerators synchrotrons); Pattern recognition cluster finding calibration and fitting methodsEnergy (signal processing)
researchProduct

CERN-MEDICIS: A Review Since Commissioning in 2017

2021

The CERN-MEDICIS (MEDical Isotopes Collected from ISolde) facility has delivered its first radioactive ion beam at CERN (Switzerland) in December 2017 to support the research and development in nuclear medicine using non-conventional radionuclides. Since then, fourteen institutes, including CERN, have joined the collaboration to drive the scientific program of this unique installation and evaluate the needs of the community to improve the research in imaging, diagnostics, radiation therapy and personalized medicine. The facility has been built as an extension of the ISOLDE (Isotope Separator On Line DEvice) facility at CERN. Handling of open radioisotope sources is made possible thanks to i…

Medicine (General)HIGH-ENERGYIon beamNuclear engineeringHigh resolutionProton Synchrotron Booster01 natural sciencesmedicalISOLDE030218 nuclear medicine & medical imaginglaw.invention03 medical and health sciencesR5-9200302 clinical medicineMedicine General & InternallawGeneral & Internal Medicine0103 physical sciencesCERNNuclear Physics - ExperimentBeam dump010306 general physicsradionuclidesOriginal ResearchLarge Hadron ColliderScience & TechnologyGeneral MedicineMass separationHandling systemmass separationBeamlineMEDICISMedicineEnvironmental scienceLife Sciences & Biomedicine
researchProduct

The effects of precipitates on CdZnTe device performance

2005

A high-intensity X-ray beam collimated down to a 10-micrometer spot size, available at Brookhaven's National Synchrotron Light Source (NSLS), was employed to perform X-ray mapping to measure the correlation between microscopic defects (precipitates) and variations in the collected charges in long-drift CdZnTe (CZT) detectors. First, we use X-ray diffraction topography (XDT) measurements at the high-energy beamline and IR microscopy to identify the defects distribution and strains in the bulk of CZT crystals. Then, we perform X-ray raster scans of the CZT detectors to measure their responses with 10-micrometer spatial resolution. The brightness of the source allows for good statistics in ver…

National Synchrotron Light SourceMaterials scienceOpticsBeamlinebusiness.industryMicroscopyDiffraction topographyInfrared microscopybusinessImage resolutionParticle detectorCollimated lightHard X-Ray and Gamma-Ray Detector Physics VII
researchProduct

Study of the response of the ATLAS central calorimeter to pions of energies from 3 to 9 GeV

2009

Çetin, Serkant Ali (Dogus Author) A fully instrumented slice of the ATLAS central detector was exposed to test beams from the SPS (Super Proton Synchrotron) at CERN in 2004. In this paper, the response of the central calorimeters to pions with energies in the range between 3 and 9 GeV is presented. The linearity and the resolution of the combined calorimetry (electromagnetic and hadronic calorimeters) was measured and compared to the prediction of a detector simulation program using the toolkit Geant 4.

Nuclear and High Energy PhysicsParticle physicsPhysics::Instrumentation and DetectorsHadronNuclear TheoryCalorimetry01 natural sciencesNuclear physicsPionAtlas (anatomy)0103 physical sciencesmedicineCalibration[PHYS.PHYS.PHYS-INS-DET]Physics [physics]/Physics [physics]/Instrumentation and Detectors [physics.ins-det]010306 general physicsNuclear ExperimentInstrumentationPhysicsLarge Hadron Collider010308 nuclear & particles physicsDetectorATLASSuper Proton SynchrotronCalorimetermedicine.anatomical_structureCalibrationPhysics::Accelerator PhysicsHigh Energy Physics::ExperimentTest beamSimulation
researchProduct